Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95780-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-23 (17) NLVSLGLTVSKPELISR PA
1
36-65 (30) HETIAKPPAMSSHYTEDLLPEQCMQDSFQK PA
1
71-82 (12) YGSCGLEDLHLR PA
2
84-92 (9) DGENVGECK PA
2
96-111 (16) EIYNGLNQCLSTLPSK PA
2
152-160 (9) SHSGLSYHK PA
2
168-176 (9) LCICEECGK PA
2
190-198 (9) IHTGEKPYK PA
242
205-214 (10) AFNWCSSLTK PA
2
218-226 (9) IHTGEKPYK PA
242
233-242 (10) AFHWCSPFVR PA
2
246-260 (15) IHTGEKPYTCEDCGR PA
2
289-301 (13) AFNHCSLLTIHER PA
2
302-310 (9) THTGEKPYK PA
107
317-328 (12) AFNSSSILTEHK PA
2
329-338 (10) VIHSGEKPYK PA
3
358-366 (9) IHTGEKPYK PA
242
373-384 (12) AFNWSSILTEHK PA
2
386-400 (15) IHTGEKPYNCEECGK PA
5
433-440 (8) CSHLNEHK PA
2
454-466 (13) CGEAFNHCSNLTT PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center