Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O96006-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-14 (10) SLESSQTDLK PA
0
28-43 (16) YFGFDTNAEGCILQWK PA
0
49-69 (21) ICMAQIAYSGNTSNLSYHLEK PA
0
70-80 (11) NHPEEFCEFVK PA
0
88-96 (9) EAFATAFSK PA
0
97-113 (17) LKPESSQQPGQDALAVK PA
0
114-121 (8) AGHGYDSK PA
0
123-150 (28) QQELTAAVLGLICEGLYPASIVDEPTFK PA
0
187-202 (16) ELAEATWCGISTDMWR PA
0
209-231 (23) AYVTLAAHFLGLGAPNCLSMGSR PA
0
235-249 (15) TFEVPEENTAETITR PA
0
250-263 (14) VLYEVFIEWGISAK PA
0
264-273 (10) VFGATTNYGK PA
0
278-307 (30) ACSLLDVAVHMPCLGHTFNAGIQQAFQLPK PA
0
318-335 (18) LVEYFQQSAVAMYMLYEK PA
0
338-350 (13) QQNVAHCMLVSNR PA
0
351-363 (13) VSWWGSTLAMLQR PA
0
366-405 (40) EQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFK PA
0
406-415 (10) QVAEMLSASR PA
0
416-437 (22) YPTISMVKPLLHMLLNTTLNIK PA
0
458-478 (21) TYQETPEIDMFLNVATFLDPR PA
0
482-490 (9) LPFLSAFER PA
0
510-519 (10) DGGYRPAEDK PA
0
520-530 (11) IFPVPEEPPVK PA
0
535-576 (42) TSTPPPASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFK PA
0
580-589 (10) VLGLNEDPLK PA
0
595-603 (9) LALFPLLPK PA
0
608-615 (8) YWCVTATR PA
0
621-632 (12) LFGSAANVVSAK PA
0
636-652 (17) LAPAHVDEQVFLYENAR PA
0
653-689 (37) SGAEAEPEDQDEGEWGLDQEQVFSLGDGVSGGFFGIR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center