Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P00167-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MAEQSDEAVK PA
2
11-19 (9) YYTLEEIQK PA
2
25-33 (9) STWLILHHK PA
2
40-52 (13) FLEEHPGGEEVLR PA
2
53-73 (21) EQAGGDATENFEDVGHSTDAR PA
2
78-118 (41) TFIIGELHPETLITTIDSSSSWWTNWVIPAISAVAVALMYR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center