Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P00540-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MPSPLALRPYLR PA
0
13-33 (21) SEFSPSVDARPCSSPSELPAK PA
0
34-42 (9) LLLGATLPR PA
0
50-65 (16) LAWCSIDWEQVCLLQR PA
0
66-76 (11) LGAGGFGSVYK PA
0
102-111 (10) SFWAELNVAR PA
0
127-168 (42) TPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCR PA
0
169-177 (9) TGGQLSLGK PA
0
181-216 (36) YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCK PA
0
217-225 (9) ISDFGCSEK PA
0
226-246 (21) LEDLLCFQTPSYPLGGTYTHR PA
0
260-275 (16) ADIYSFAITLWQMTTK PA
0
276-283 (8) QAPYSGER PA
0
284-312 (29) QHILYAVVAYDLRPSLSAAVFEDSLPGQR PA
0
320-332 (13) CWRPSAAQRPSAR PA
0
333-342 (10) LLLVDLTSLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center