Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P00915-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MASPDWGYDDK PA
0
12-19 (8) NGPEQWSK PA
0
20-35 (16) LYPIANGNNQSPVDIK PA
0
41-58 (18) HDTSLKPISVSYNPATAK PA
0
59-77 (19) EIINVGHSFHVNFEDNDNR PA
0
82-90 (9) GGPFSDSYR PA
0
91-114 (24) LFQFHFHWGSTNEHGSEHTVDGVK PA
0
115-128 (14) YSAELHVAHWNSAK PA
0
129-138 (10) YSSLAEAASK PA
0
139-150 (12) ADGLAVIGVLMK PA
0
161-169 (9) VLDALQAIK PA
0
175-214 (40) APFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICK PA
0
215-228 (14) ESISVSSEQLAQFR PA
0
229-253 (25) SLLSNVEGDNAVPMQHNNRPTQPLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center