Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04196-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-33 (31) ALIAALLLITLQYSCAVSPTDCSAVEPEAEK PA
0
44-52 (9) DGYLFQLLR PA
0
53-60 (8) IADAHLDR PA
0
61-83 (23) VENTTVYYLVLDVQESDCSVLSR PA
0
85-95 (11) YWNDCEPPDSR PA
0
96-106 (11) RPSEIVIGQCK PA
0
112-120 (9) HSHESQDLR PA
0
121-139 (19) VIDFNCTTSSVSSALANTK PA
0
140-153 (14) DSPVLIDFFEDTER PA
0
167-176 (10) EENDDFASFR PA
0
188-201 (14) GGEGTGYFVDFSVR PA
0
211-219 (9) HPNVFGFCR PA
0
220-235 (16) ADLFYDVEALDLESPK PA
0
236-270 (35) NLVINCEVFDPQEHENINGVPPHLGHPFHWGGHER PA
0
271-284 (14) SSTTKPPFKPHGSR PA
0
285-304 (20) DHHHPHKPHEHGPPPPPDER PA
0
305-339 (35) DHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQR PA
0
340-353 (14) HSHNNNSSDLHPHK PA
0
354-378 (25) HHSHEQHPHGHHPHAHHPHEHDTHR PA
0
379-439 (61) QHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPPPHNQGHCCHGHGPPPGHLR PA
0
446-453 (8) GPRPFHCR PA
0
467-486 (20) GEVLPLPEANFPSFPLPHHK PA
0
487-507 (21) HPLKPDNQPFPQSVSESCPGK PA
0
510-525 (16) SGFPQVSMFFTHTFPK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center