Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04198-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MPSCSTSTMPGMICK PA
0
16-51 (36) NPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWK PA
0
53-65 (13) FELLPTPPLSPSR PA
2
66-123 (58) GFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAR PA
0
139-160 (22) GPPTAGSTAQSPGAGAASPAGR PA
0
161-170 (10) GHGGAAGAGR PA
0
171-199 (29) AGAALPAELAHPAAECVDPAVVFPFPVNK PA
0
201-242 (42) EPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGR PA
0
243-250 (8) QTSGGDHK PA
0
251-284 (34) ALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEK PA
0
293-304 (12) AVTTFTITVRPK PA
0
305-312 (8) NAALGPGR PA
0
313-321 (9) AQSSELILK PA
0
323-348 (26) CLPIHQQHNYAAPSPYVESEDAPPQK PA
0
352-360 (9) SEASPRPLK PA
0
374-382 (9) NSDSEDSER PA
0
406-413 (8) DHVPELVK PA
0
426-444 (19) ATEYVHSLQAEEHQLLLEK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center