Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04275-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-27 (22) FAGVLLALALILPGTLCAEGTR PA
0
35-67 (33) CSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQK PA
1
69-80 (12) SFSIIGDFQNGK PA
1
82-108 (27) VSLSVYLGEFFDIHLFVNGTVTQGDQR PA
1
109-116 (8) VSMPYASK PA
1
117-128 (12) GLYLETEAGYYK PA
1
129-139 (11) LSGEAYGFVAR PA
1
140-153 (14) IDGSGNFQVLLSDR PA
1
158-202 (45) TCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCER PA
1
203-219 (17) ASPPSSSCNISSGEMQK PA
1
220-229 (10) GLWEQCQLLK PA
0
237-252 (16) CHPLVDPEPFVALCEK PA
0
253-273 (21) TLCECAGGLECACPALLEYAR PA
0
274-302 (29) TCAQEGMVLYGWTDHSACSPVCPAGMEYR PA
0
303-310 (8) QCVSPCAR PA
0
311-324 (14) TCQSLHINEMCQER PA
0
325-355 (31) CVDGCSCPEGQLLDEGLCVESTECPCVHSGK PA
0
357-365 (9) YPPGTSLSR PA
0
366-373 (8) DCNTCICR PA
0
374-397 (24) NSQWICSNEECPGECLVTGQSHFK PA
0
403-416 (14) YFTFSGICQYLLAR PA
0
417-436 (20) DCQDHSFSIVIETVQCADDR PA
0
448-457 (10) LPGLHNSLVK PA
0
460-477 (18) HGAGVAMDGQDVQLPLLK PA
0
482-491 (10) IQHTVTASVR PA
0
492-505 (14) LSYGEDLQMDWDGR PA
0
512-519 (8) LSPVYAGK PA
0
520-545 (26) TCGLCGNYNGNQGDDFLTPSGLAEPR PA
0
546-554 (9) VEDFGNAWK PA
0
555-564 (10) LHGDCQDLQK PA
0
565-575 (11) QHSDPCALNPR PA
0
579-597 (19) FSEEACAVLTSPTFEACHR PA
0
598-606 (9) AVSPLPYLR PA
0
610-619 (10) YDVCSCSDGR PA
0
620-636 (17) ECLCGALASYAAACAGR PA
0
655-670 (16) GQVYLQCGTPCNLTCR PA
0
671-698 (28) SLSYPDEECNEACLEGCFCPPGLYMDER PA
0
705-760 (56) AQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHR PA
0
764-773 (10) SLSCRPPMVK PA
0
774-782 (9) LVCPADNLR PA
0
783-790 (8) AEGLECTK PA
0
791-816 (26) TCQNYDLECMSMGCVSGCLCPPGMVR PA
0
827-834 (8) CPCFHQGK PA
0
835-843 (9) EYAPGETVK PA
0
844-854 (11) IGCNTCVCQDR PA
0
856-882 (27) WNCTDHVCDATCSTIGMAHYLTFDGLK PA
0
883-906 (24) YLFPGECQYVLVQDYCGSNPGTFR PA
0
913-920 (8) GCSHPSVK PA
0
925-944 (20) VTILVEGGEIELFDGEVNVK PA
0
949-960 (12) DETHFEVVESGR PA
0
961-968 (8) YIILLLGK PA
0
969-976 (8) ALSVVWDR PA
0
977-985 (9) HLSISVVLK PA
0
992-1026 (35) VCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGNSWK PA
0
1027-1035 (9) VSSQCADTR PA
0
1037-1052 (16) VPLDSSPATCHNNIMK PA
0
1053-1061 (9) QTMVDSSCR PA
0
1062-1073 (12) ILTSDVFQDCNK PA
0
1074-1116 (43) LVDPEPYLDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGK PA
0
1122-1133 (12) TATLCPQSCEER PA
0
1137-1145 (9) ENGYECEWR PA
0
1146-1181 (36) YNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGK PA
0
1182-1204 (23) ILDELLQTCVDPEDCPVCEVAGR PA
0
1212-1274 (63) VTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVEDISEPPLHDFYCSR PA
0
1275-1287 (13) LLDLVFLLDGSSR PA
0
1288-1297 (10) LSEAEFEVLK PA
0
1298-1306 (9) AFVVDMMER PA
0
1316-1332 (17) VAVVEYHDGSHAYIGLK PA
0
1349-1362 (14) YAGSQVASTSEVLK PA
0
1363-1371 (9) YTLFQIFSK PA
0
1372-1379 (8) IDRPEASR PA
0
1380-1392 (13) ITLLLMASQEPQR PA
0
1409-1423 (15) VIVIPVGIGPHANLK PA
0
1437-1450 (14) AFVLSSVDELEQQR PA
0
1451-1491 (41) DEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPK PA
0
1493-1508 (16) NSMVLDVAFVLEGSDK PA
0
1509-1516 (8) IGEADFNR PA
0
1519-1527 (9) EFMEEVIQR PA
0
1528-1558 (31) MDVGQDSIHVTVLQYSYMVTVEYPFSEAQSK PA
0
1576-1583 (8) TNTGLALR PA
0
1584-1597 (14) YLSDHSFLVSQGDR PA
0
1598-1617 (20) EQAPNLVYMVTGNPASDEIK PA
0
1619-1641 (23) LPGDIQVVPIGVGPNANVQELER PA
0
1642-1659 (18) IGWPNAPILIQDFETLPR PA
0
1660-1668 (9) EAPDLVLQR PA
0
1669-1711 (43) CCSGEGLQIPTLSPAPDCSQPLDVILLLDGSSSFPASYFDEMK PA
0
1727-1751 (25) LTQVSVLQYGSITTIDVPWNVVPEK PA
0
1752-1763 (12) AHLLSLVDVMQR PA
0
1764-1779 (16) EGGPSQIGDALGFAVR PA
0
1780-1794 (15) YLTSEMHGARPGASK PA
0
1795-1816 (22) AVVILVTDVSVDSVDAAADAAR PA
0
1820-1830 (11) VTVFPIGIGDR PA
0
1838-1850 (13) ILAGPAGDSNVVK PA
0
1854-1870 (17) IEDLPTMVTLGNSFLHK PA
0
1878-1887 (10) ICMDEDGNEK PA
0
1888-1913 (26) RPGDVWTLPDQCHTVTCQPDGQTLLK PA
0
1922-1935 (14) GLRPSCPNSQSPVK PA
0
1936-1943 (8) VEETCGCR PA
0
1944-1956 (13) WTCPCVCTGSSTR PA
0
1957-1967 (11) HIVTFDGQNFK PA
0
1968-1980 (13) LTGSCSYVLFQNK PA
0
1981-1998 (18) EQDLEVILHNGACSPGAR PA
0
2009-2027 (19) HSALSVELHSDMEVTVNGR PA
0
2028-2051 (24) LVSVPYVGGNMEVNVYGAIMHEVR PA
0
2052-2075 (24) FNHLGHIFTFTPQNNEFQLQLSPK PA
0
2081-2099 (19) TYGLCGICDENGANDFMLR PA
0
2100-2108 (9) DGTVTTDWK PA
0
2109-2152 (44) TLVQEWTVQRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHK PA
0
2153-2185 (33) VLAPATFYAICQQDSCHQEQVCEVIASYAHLCR PA
0
2186-2194 (9) TNGVCVDWR PA
0
2195-2218 (24) TPDFCAMSCPPSLVYNHCEHGCPR PA
0
2219-2241 (23) HCDGNVSSCGDHPSEGCFCPPDK PA
0
2242-2287 (46) VMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTCLSGR PA
0
2289-2300 (12) VNCTTQPCPTAK PA
0
2301-2311 (11) APTCGLCEVAR PA
0
2314-2342 (29) QNADQCCPEYECVCDPVSCDLPPVPHCER PA
0
2343-2363 (21) GLQPTLTNPGECRPNFTCACR PA
0
2370-2379 (10) VSPPSCPPHR PA
0
2386-2429 (44) TQCCDEYECACNCVNSTVSCPLGYLASTATNDCGCTTTTCLPDK PA
0
2435-2464 (30) STIYPVGQFWEEGCDVCTCTDMEDAVMGLR PA
0
2465-2478 (14) VAQCSQKPCEDSCR PA
0
2479-2493 (15) SGFTYVLHEGECCGR PA
0
2494-2507 (14) CLPSACEVVTGSPR PA
0
2508-2515 (8) GDSQSSWK PA
0
2516-2535 (20) SVGSQWASPENPCLINECVR PA
0
2538-2545 (8) EEVFIQQR PA
0
2546-2566 (21) NVSCPQLEVPVCPSGFQLSCK PA
0
2567-2575 (9) TSACCPSCR PA
0
2579-2593 (15) MEACMLNGTVIGPGK PA
0
2594-2604 (11) TVMIDVCTTCR PA
0
2605-2616 (12) CMVQVGVISGFK PA
0
2622-2632 (11) TTCNPCPLGYK PA
0
2633-2643 (11) EENNTGECCGR PA
0
2644-2654 (11) CLPTACTIQLR PA
0
2655-2662 (8) GGQIMTLK PA
0
2664-2677 (14) DETLQDGCDTHFCK PA
0
2690-2700 (11) VTGCPPFDEHK PA
0
2711-2730 (20) IPGTCCDTCEEPECNDITAR PA
0
2741-2753 (13) SEVEVDIHYCQGK PA
1
2758-2778 (21) AMYSIDINDVQDQCSCCSPTR PA
1
2779-2805 (27) TEPMQVALHCTNGSVVYHEVLNAMECK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center