Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04275-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MGAQDEEEGIQDLDGLLVFDK PA
0
22-41 (20) IVEVTLLNLPWYNEETEGQR PA
0
56-64 (9) GTLCAEGTR PA
0
72-104 (33) CSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQK PA
1
106-117 (12) SFSIIGDFQNGK PA
1
119-145 (27) VSLSVYLGEFFDIHLFVNGTVTQGDQR PA
1
146-153 (8) VSMPYASK PA
1
154-165 (12) GLYLETEAGYYK PA
1
166-176 (11) LSGEAYGFVAR PA
1
177-190 (14) IDGSGNFQVLLSDR PA
1
195-239 (45) TCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCER PA
1
240-256 (17) ASPPSSSCNISSGEMQK PA
1
257-267 (11) EEPECNDITAR PA
0
278-290 (13) SEVEVDIHYCQGK PA
1
295-315 (21) AMYSIDINDVQDQCSCCSPTR PA
1
316-342 (27) TEPMQVALHCTNGSVVYHEVLNAMECK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center