Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04626-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MELAALCR PA
1
9-32 (24) WGLLLALLPPGAASTQVCTGTDMK PA
1
35-47 (13) LPASPETHLDMLR PA
3
48-92 (45) HLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVR PA
3
104-138 (35) GTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLR PA
3
158-170 (13) NPQLCYQDTILWK PA
3
176-188 (13) NNQLALTLIDTNR PA
3
191-200 (10) ACHPCSPMCK PA
3
204-217 (14) CWGESSEDCQSLTR PA
3
218-226 (9) TVCAGGCAR PA
3
229-248 (20) GPLPTDCCHEQCAAGCTGPK PA
3
249-288 (40) HSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGR PA
3
289-330 (42) YTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQR PA
3
341-351 (11) VCYGLGMEHLR PA
3
355-368 (14) AVTSANIQEFAGCK PA
3
370-432 (63) IFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIR PA
3
435-456 (22) ILHNGAYSLTLQGLGISWLGLR PA
3
460-487 (28) ELGSGLALIHHNTHLCFVHTVPWDQLFR PA
3
488-517 (30) NPHQALLHTANRPEDECVGEGLACHQLCAR PA
3
518-536 (19) GHCWGPGPTQCVNCSQFLR PA
3
537-545 (9) GQECVEECR PA
3
559-591 (33) HCLPCHPECQPQNGSVTCFGPEADQCVACAHYK PA
3
592-599 (8) DPPFCVAR PA
3
600-615 (16) CPSGVKPDLSYMPIWK PA
3
616-640 (25) FPDEEGACQPCPINCTHSCVDLDDK PA
3
648-676 (29) ASPLTSIISAVVGILLVVVLGVVFGILIK PA
3
690-713 (24) LLQETELVEPLTPSGAMPNQAQMR PA
5
725-736 (12) VLGSGAFGTVYK PA
10
737-747 (11) GIWIPDGENVK PA
5
766-784 (19) EILDEAYVMAGVGSPYVSR PA
4
785-811 (27) LLGICLTSTVQLVTQLMPYGCLLDHVR PA
4
817-831 (15) LGSQDLLNWCMQIAK PA
4
832-840 (9) GMSYLEDVR PA
4
861-868 (8) ITDFGLAR PA
15
869-883 (15) LLDIDETEYHADGGK PA
4
888-896 (9) WMALESILR PA
4
899-929 (31) FTHQSDVWSYGVTVWELMTFGAKPYDGIPAR PA
4
930-937 (8) EIPDLLEK PA
8
941-957 (17) LPQPPICTIDVYMIMVK PA
5
958-968 (11) CWMIDSECRPR PA
4
971-978 (8) ELVSEFSR PA
4
986-1006 (21) FVVIQNEDLGPASPLDSTFYR PA
4
1007-1046 (40) SLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHR PA
4
1054-1072 (19) SGGGDLTLGLEPSEEEAPR PA
4
1073-1096 (24) SPLAPSEGAGSDVFDGDLGMGAAK PA
4
1097-1111 (15) GLQSLPTHDPSPLQR PA
4
1112-1153 (42) YSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPR PA
4
1154-1171 (18) EGPLPAARPAGATLERPK PA
4
1183-1230 (48) DVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPER PA
4
1231-1238 (8) GAPPSTFK PA
4
1239-1255 (17) GTPTAENPEYLGLDVPV PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center