Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04626-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-27 (24) LLQETELVEPLTPSGAMPNQAQMR PA
5
39-50 (12) VLGSGAFGTVYK PA
10
51-61 (11) GIWIPDGENVK PA
5
80-98 (19) EILDEAYVMAGVGSPYVSR PA
4
99-125 (27) LLGICLTSTVQLVTQLMPYGCLLDHVR PA
4
131-145 (15) LGSQDLLNWCMQIAK PA
4
146-154 (9) GMSYLEDVR PA
4
175-182 (8) ITDFGLAR PA
15
183-197 (15) LLDIDETEYHADGGK PA
4
202-210 (9) WMALESILR PA
4
213-243 (31) FTHQSDVWSYGVTVWELMTFGAKPYDGIPAR PA
4
244-251 (8) EIPDLLEK PA
8
255-271 (17) LPQPPICTIDVYMIMVK PA
5
272-282 (11) CWMIDSECRPR PA
4
285-292 (8) ELVSEFSR PA
4
300-320 (21) FVVIQNEDLGPASPLDSTFYR PA
4
321-360 (40) SLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHR PA
4
368-386 (19) SGGGDLTLGLEPSEEEAPR PA
4
387-410 (24) SPLAPSEGAGSDVFDGDLGMGAAK PA
4
411-425 (15) GLQSLPTHDPSPLQR PA
4
426-467 (42) YSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPR PA
4
468-485 (18) EGPLPAARPAGATLERPK PA
4
497-544 (48) DVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPER PA
4
545-552 (8) GAPPSTFK PA
4
553-569 (17) GTPTAENPEYLGLDVPV PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center