Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04626-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-17 (14) GSWKPQVCTGTDMK PA
0
20-32 (13) LPASPETHLDMLR PA
3
33-77 (45) HLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVR PA
3
89-123 (35) GTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLR PA
3
143-155 (13) NPQLCYQDTILWK PA
3
161-173 (13) NNQLALTLIDTNR PA
3
176-185 (10) ACHPCSPMCK PA
3
189-202 (14) CWGESSEDCQSLTR PA
3
203-211 (9) TVCAGGCAR PA
3
214-233 (20) GPLPTDCCHEQCAAGCTGPK PA
3
234-273 (40) HSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGR PA
3
274-315 (42) YTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQR PA
3
326-336 (11) VCYGLGMEHLR PA
3
340-353 (14) AVTSANIQEFAGCK PA
3
355-417 (63) IFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIR PA
3
420-441 (22) ILHNGAYSLTLQGLGISWLGLR PA
3
445-472 (28) ELGSGLALIHHNTHLCFVHTVPWDQLFR PA
3
473-502 (30) NPHQALLHTANRPEDECVGEGLACHQLCAR PA
3
503-521 (19) GHCWGPGPTQCVNCSQFLR PA
3
522-530 (9) GQECVEECR PA
3
544-576 (33) HCLPCHPECQPQNGSVTCFGPEADQCVACAHYK PA
3
577-584 (8) DPPFCVAR PA
3
585-600 (16) CPSGVKPDLSYMPIWK PA
3
601-625 (25) FPDEEGACQPCPINCTHSCVDLDDK PA
3
633-661 (29) ASPLTSIISAVVGILLVVVLGVVFGILIK PA
3
675-698 (24) LLQETELVEPLTPSGAMPNQAQMR PA
5
710-721 (12) VLGSGAFGTVYK PA
10
722-732 (11) GIWIPDGENVK PA
5
751-769 (19) EILDEAYVMAGVGSPYVSR PA
4
770-796 (27) LLGICLTSTVQLVTQLMPYGCLLDHVR PA
4
802-816 (15) LGSQDLLNWCMQIAK PA
4
817-825 (9) GMSYLEDVR PA
4
846-853 (8) ITDFGLAR PA
15
854-868 (15) LLDIDETEYHADGGK PA
4
873-881 (9) WMALESILR PA
4
884-914 (31) FTHQSDVWSYGVTVWELMTFGAKPYDGIPAR PA
4
915-922 (8) EIPDLLEK PA
8
926-942 (17) LPQPPICTIDVYMIMVK PA
5
943-953 (11) CWMIDSECRPR PA
4
956-963 (8) ELVSEFSR PA
4
971-991 (21) FVVIQNEDLGPASPLDSTFYR PA
4
992-1031 (40) SLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHR PA
4
1039-1057 (19) SGGGDLTLGLEPSEEEAPR PA
4
1058-1081 (24) SPLAPSEGAGSDVFDGDLGMGAAK PA
4
1082-1096 (15) GLQSLPTHDPSPLQR PA
4
1097-1138 (42) YSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPR PA
4
1139-1156 (18) EGPLPAARPAGATLERPK PA
4
1168-1215 (48) DVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPER PA
4
1216-1223 (8) GAPPSTFK PA
4
1224-1240 (17) GTPTAENPEYLGLDVPV PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center