Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04626-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MELAALCR PA
1
9-32 (24) WGLLLALLPPGAASTQVCTGTDMK PA
1
35-47 (13) LPASPETHLDMLR PA
3
48-92 (45) HLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVR PA
3
104-138 (35) GTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLR PA
3
158-170 (13) NPQLCYQDTILWK PA
3
176-188 (13) NNQLALTLIDTNR PA
3
191-200 (10) ACHPCSPMCK PA
3
204-217 (14) CWGESSEDCQSLTR PA
3
218-226 (9) TVCAGGCAR PA
3
229-248 (20) GPLPTDCCHEQCAAGCTGPK PA
3
249-288 (40) HSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGR PA
3
289-330 (42) YTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQR PA
3
341-351 (11) VCYGLGMEHLR PA
3
355-368 (14) AVTSANIQEFAGCK PA
3
370-432 (63) IFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIR PA
3
435-456 (22) ILHNGAYSLTLQGLGISWLGLR PA
3
460-487 (28) ELGSGLALIHHNTHLCFVHTVPWDQLFR PA
3
488-517 (30) NPHQALLHTANRPEDECVGEGLACHQLCAR PA
3
518-536 (19) GHCWGPGPTQCVNCSQFLR PA
3
537-545 (9) GQECVEECR PA
3
559-591 (33) HCLPCHPECQPQNGSVTCFGPEADQCVACAHYK PA
3
592-599 (8) DPPFCVAR PA
3
600-615 (16) CPSGVKPDLSYMPIWK PA
3
616-660 (45) FPDEEGACQPCPINCTHSPLTSIISAVVGILLVVVLGVVFGILIK PA
0
674-697 (24) LLQETELVEPLTPSGAMPNQAQMR PA
5
709-720 (12) VLGSGAFGTVYK PA
10
721-731 (11) GIWIPDGENVK PA
5
750-766 (17) EILDETISNLFSNFAPR PA
0
767-781 (15) GPSACCPTCWCHSGK PA
0
815-830 (16) SCPSAPPSSCLQPSLR PA
0
831-841 (11) QPLLLGPGPTR PA
0
842-851 (10) AGGSTQHLQR PA
0
874-886 (13) SAEALMCPQGAGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center