Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04637-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MEEPQSDPSVEPPLSQETFSDLWK PA
2
25-65 (41) LLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPR PA
2
66-101 (36) MPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQK PA
5
102-110 (9) TYQGSYGFR PA
5
111-120 (10) LGFLHSGTAK PA
5
121-132 (12) SVTCTYSPALNK PA
5
140-156 (17) TCPVQLWVDSTPPPGTR PA
8
165-174 (10) QSQHMTEVVR PA
8
182-196 (15) CSDSDGLAPPQHLIR PA
8
214-248 (35) HSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNR PA
8
249-267 (19) RPILTIITLEDSSGNLLGR PA
8
293-305 (13) GEPHHELPPGSTK PA
8
307-319 (13) ALPNNTSSSPQPK PA
8
321-338 (18) KPLDGEYFTLQDQTSFQK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center