Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04637-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-26 (26) MDDLMLSPDDIEQWFTEDPGPDEAPR PA
2
27-62 (36) MPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQK PA
5
63-71 (9) TYQGSYGFR PA
5
72-81 (10) LGFLHSGTAK PA
5
82-93 (12) SVTCTYSPALNK PA
5
101-117 (17) TCPVQLWVDSTPPPGTR PA
8
126-135 (10) QSQHMTEVVR PA
8
143-157 (15) CSDSDGLAPPQHLIR PA
8
175-209 (35) HSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNR PA
8
210-228 (19) RPILTIITLEDSSGNLLGR PA
8
254-266 (13) GEPHHELPPGSTK PA
8
268-280 (13) ALPNNTSSSPQPK PA
8
282-294 (13) KPLDGEYFTLQIR PA
2
304-312 (9) ELNEALELK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center