Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P04843-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-37 (37) MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVK PA
0
39-48 (10) TVDLSSHLAK PA
0
49-65 (17) VTAEVVLAHLGGGSTSR PA
0
66-80 (15) ATSFLLALEPELEAR PA
0
81-89 (9) LAHLGVQVK PA
0
90-101 (12) GEDEEENNLEVR PA
0
117-126 (10) LPVALDPGAK PA
0
127-151 (25) ISVIVETVYTHVLHPYPTQITQSEK PA
0
152-169 (18) QFVVFEGNHYFYSPYPTK PA
0
194-204 (11) SEDLLDYGPFR PA
0
205-215 (11) DVPAYSQDTFK PA
0
216-232 (17) VHYENNSPFLTITSMTR PA
0
233-251 (19) VIEVSHWGNIAVEENVDLK PA
0
269-278 (10) QPDSGISSIR PA
0
282-294 (13) TILPAAAQDVYYR PA
0
295-319 (25) DEIGNVSTSHLLILDDSVEMEIRPR PA
0
320-327 (8) FPLFGGWK PA
0
328-352 (25) THYIVGYNLPSYEYLYNLGDQYALK PA
0
355-371 (17) FVDHVFDEQVIDSLTVK PA
0
372-379 (8) IILPEGAK PA
0
380-391 (12) NIEIDSPYEISR PA
0
392-413 (22) APDELHYTYLDTFGRPVIVAYK PA
0
415-432 (18) NLVEQHIQDIVVHYTFNK PA
0
433-458 (26) VLMLQEPLLVVAAFYILFFTVIIYVR PA
0
475-488 (14) VACITEQVLTLVNK PA
0
495-502 (8) HFDETVNR PA
0
508-516 (9) DISTLNSGK PA
0
525-536 (12) ALTSEIALLQSR PA
0
539-547 (9) TEGSDLCDR PA
0
580-587 (8) DTYIENEK PA
0
600-607 (8) IDHILDAL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center