Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P06396-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MVVEHPEFLK PA
0
14-21 (8) EPGLQIWR PA
3
25-48 (24) FDLVPVPTNLYGDFFTGDAYVILK PA
3
54-91 (38) NGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGR PA
3
97-111 (15) EVQGFESATFLGYFK PA
3
119-126 (8) GGVASGFK PA
3
127-137 (11) HVVPNEVVVQR PA
3
149-183 (35) ATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNR PA
3
207-238 (32) VHVSEEGTEPEAMLQVLGPKPALPAGTEDTAK PA
3
252-276 (25) VSNGAGTMSVSLVADENPFAQGALK PA
3
277-287 (11) SEDCFILDHGK PA
3
310-317 (8) TASDFITK PA
3
323-339 (17) QTQVSVLPEGGETPLFK PA
3
347-368 (22) DPDQTDGLGLSYLSSHIANVER PA
3
369-396 (28) VPFDAATLHTSTAMAAQHGMDDDGTGQK PA
3
407-430 (24) VPVDPATYGQFYGGDSYIILYNYR PA
3
435-474 (40) QGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSR PA
3
480-497 (18) EPAHLMSLFGGKPMIIYK PA
3
503-513 (11) EGGQTAPASTR PA
3
519-526 (8) ANSAGATR PA
3
534-546 (13) AGALNSNDAFVLK PA
3
547-564 (18) TPSAAYLWVGTGASEAEK PA
3
565-572 (8) TGAQELLR PA
3
576-597 (22) AQPVQVAEGSEPDGFWEALGGK PA
3
628-662 (35) FVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGK PA
3
670-677 (8) TEALTSAK PA
3
679-687 (9) YIETDPANR PA
3
698-724 (27) QGFEPPSFVGWFLGWDDDYWSVDPLDR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center