Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P06396-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-21 (18) LFCCFPNSMVVEHPEFLK PA
0
25-32 (8) EPGLQIWR PA
3
36-59 (24) FDLVPVPTNLYGDFFTGDAYVILK PA
3
65-102 (38) NGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGR PA
3
108-122 (15) EVQGFESATFLGYFK PA
3
130-137 (8) GGVASGFK PA
3
138-148 (11) HVVPNEVVVQR PA
3
160-194 (35) ATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNR PA
3
218-249 (32) VHVSEEGTEPEAMLQVLGPKPALPAGTEDTAK PA
3
263-287 (25) VSNGAGTMSVSLVADENPFAQGALK PA
3
288-298 (11) SEDCFILDHGK PA
3
321-328 (8) TASDFITK PA
3
334-350 (17) QTQVSVLPEGGETPLFK PA
3
358-379 (22) DPDQTDGLGLSYLSSHIANVER PA
3
380-407 (28) VPFDAATLHTSTAMAAQHGMDDDGTGQK PA
3
418-441 (24) VPVDPATYGQFYGGDSYIILYNYR PA
3
446-485 (40) QGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSR PA
3
491-508 (18) EPAHLMSLFGGKPMIIYK PA
3
514-524 (11) EGGQTAPASTR PA
3
530-537 (8) ANSAGATR PA
3
545-557 (13) AGALNSNDAFVLK PA
3
558-575 (18) TPSAAYLWVGTGASEAEK PA
3
576-583 (8) TGAQELLR PA
3
587-608 (22) AQPVQVAEGSEPDGFWEALGGK PA
3
639-673 (35) FVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGK PA
3
681-688 (8) TEALTSAK PA
3
690-698 (9) YIETDPANR PA
3
709-735 (27) QGFEPPSFVGWFLGWDDDYWSVDPLDR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center