Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P07359-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MPLLLLLLLLPSPLHPHPICEVSK PA
0
25-35 (11) VASHLEVNCDK PA
0
37-47 (11) NLTALPPDLPK PA
0
48-72 (25) DTTILHLSENLLYTFSLATLMPYTR PA
0
73-80 (8) LTQLNLDR PA
0
86-127 (42) LQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNR PA
0
128-137 (10) LTSLPLGALR PA
0
138-148 (11) GLGELQELYLK PA
0
154-165 (12) TLPPGLLTPTPK PA
0
169-205 (37) LSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPK PA
0
206-233 (28) GFFGSHLLPFAFLHGNPWLCNCEILYFR PA
0
235-247 (13) WLQDNAENVYVWK PA
0
254-269 (16) AMTSNVASVQCDNSDK PA
0
279-304 (26) GCPTLGDEGDTDLYDYYPEEDTEGDK PA
0
318-350 (33) AHTTPWGLFYSWSTASLDSQMPSSLHPTQESTK PA
0
351-358 (8) EQTTFPPR PA
0
359-374 (16) WTPNFTLHMESITFSK PA
0
378-475 (98) STTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPK PA
0
476-492 (17) STFLTTTKPVSLLESTK PA
0
494-503 (10) TIPELDQPPK PA
0
506-516 (11) GVLQGHLESSR PA
0
517-584 (68) NDPFLHPDFCCLLPLGFYVLGLFWLLFASVVLILLLSWVGHVKPQALDSGQGAALTTATQTTHLELQR PA
0
607-618 (12) SSLFLWVRPNGR PA
0
619-626 (8) VGPLVAGR PA
0
627-635 (9) RPSALSQGR PA
0
636-646 (11) GQDLLSTVSIR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center