Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P07992-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-19 (12) EGVPQPSGPPAR PA
3
22-41 (20) FVIPLDEDEVPPGVAKPLFR PA
2
42-97 (56) STQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK PA
2
98-106 (9) SNSIIVSPR PA
2
118-144 (27) NVPWEFGDVIPDYVLGQSTCALFLSLR PA
3
145-156 (12) YHNLHPDYIHGR PA
3
168-176 (9) VLLVQVDVK PA
3
188-207 (20) MCILADCTLILAWSPEEAGR PA
3
214-226 (13) AYEQKPADLLMEK PA
3
227-234 (8) LEQDFVSR PA
3
235-243 (9) VTECLTTVK PA
2
248-268 (21) TDSQTLLTTFGSLEQLIAASR PA
2
269-281 (13) EDLALCPGLGPQK PA
3
301-309 (9) HNLRPQSFK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center