Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P08151-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-57 (57) MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPAR PA
0
58-72 (15) ETNSCTEGPLFSSPR PA
0
82-100 (19) ALSISPLSDASLDLQTVIR PA
1
101-113 (13) TSPSSLVAFINSR PA
1
114-143 (30) CTSPGGSYGHLSIGTMSPSLGFPAQMNHQK PA
1
144-161 (18) GPSPSFGVQPCGPHDSAR PA
2
162-171 (10) GGMIPHPQSR PA
2
172-180 (9) GPFPTCQLK PA
2
181-189 (9) SELDMLVGK PA
2
192-218 (27) EEPLEGDMSSPNSTGIQDPLLGMLDGR PA
2
228-238 (11) EPESVYETDCR PA
2
239-265 (27) WDGCSQEFDSQEQLVHHINSEHIHGER PA
2
267-277 (11) EFVCHWGGCSR PA
2
284-293 (10) AQYMLVVHMR PA
8
295-302 (8) HTGEKPHK PA
8
324-340 (17) SHTGEKPYMCEHEGCSK PA
2
341-348 (8) AFSNASDR PA
8
355-365 (11) THSNEKPYVCK PA
3
373-380 (8) YTDPSSLR PA
12
385-395 (11) TVHGPDAHVTK PA
7
406-415 (10) APSISTVEPK PA
2
429-496 (68) LTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGTGLSTLR PA
2
503-515 (13) LDQLHQLRPIGTR PA
2
519-531 (13) LPSLSHTGTTVSR PA
2
533-541 (9) VGPPVSLER PA
2
543-557 (15) SSSSSSISSAYTVSR PA
2
559-590 (32) SSLASPFPPGSPPENGASSLPGLMPAQHYLLR PA
2
598-611 (14) GGGTSPTAASSLDR PA
2
612-621 (10) IGGLPMPPWR PA
2
624-637 (14) AEYPGYNPNAGVTR PA
2
639-653 (15) ASDPAQAADRPAPAR PA
2
659-701 (43) SLGCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDAR PA
2
702-746 (45) GLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGAR PA
2
747-794 (48) GPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETWGEFPSHSGLYPGPK PA
2
795-805 (11) ALGGTYSQCPR PA
2
806-894 (89) LEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDS
PTHSTGQLK PA
2
895-915 (21) AQLVCNYVQSQQELLWEGGGR PA
2
916-929 (14) EDAPAQEPSYQSPK PA
2
930-940 (11) FLGGSQVSPSR PA
2
943-960 (18) APVNTYGPGFGPNLPNHK PA
2
961-980 (20) SGSYPTPSPCHENFVVGANR PA
2
991-1003 (13) LLPPLPTCYGPLK PA
2
1004-1018 (15) VGGTNPSCGHPEVGR PA
2
1019-1068 (50) LGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQR PA
2
1069-1093 (25) GSSGHTPPPSGPPNMAVGNMSVLLR PA
2
1094-1106 (13) SLPGETEFLNSSA PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center