Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P08151-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-35 (35) MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEVK PA
0
41-59 (19) ALSISPLSDASLDLQTVIR PA
1
60-72 (13) TSPSSLVAFINSR PA
1
73-102 (30) CTSPGGSYGHLSIGTMSPSLGFPAQMNHQK PA
1
103-120 (18) GPSPSFGVQPCGPHDSAR PA
2
121-130 (10) GGMIPHPQSR PA
2
131-139 (9) GPFPTCQLK PA
2
140-148 (9) SELDMLVGK PA
2
151-177 (27) EEPLEGDMSSPNSTGIQDPLLGMLDGR PA
2
187-197 (11) EPESVYETDCR PA
2
198-224 (27) WDGCSQEFDSQEQLVHHINSEHIHGER PA
2
226-236 (11) EFVCHWGGCSR PA
2
243-252 (10) AQYMLVVHMR PA
8
254-261 (8) HTGEKPHK PA
8
283-299 (17) SHTGEKPYMCEHEGCSK PA
2
300-307 (8) AFSNASDR PA
8
314-324 (11) THSNEKPYVCK PA
3
332-339 (8) YTDPSSLR PA
12
344-354 (11) TVHGPDAHVTK PA
7
365-374 (10) APSISTVEPK PA
2
388-455 (68) LTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGTGLSTLR PA
2
462-474 (13) LDQLHQLRPIGTR PA
2
478-490 (13) LPSLSHTGTTVSR PA
2
492-500 (9) VGPPVSLER PA
2
502-516 (15) SSSSSSISSAYTVSR PA
2
518-549 (32) SSLASPFPPGSPPENGASSLPGLMPAQHYLLR PA
2
557-570 (14) GGGTSPTAASSLDR PA
2
571-580 (10) IGGLPMPPWR PA
2
583-596 (14) AEYPGYNPNAGVTR PA
2
598-612 (15) ASDPAQAADRPAPAR PA
2
618-660 (43) SLGCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDAR PA
2
661-705 (45) GLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGAR PA
2
706-753 (48) GPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETWGEFPSHSGLYPGPK PA
2
754-764 (11) ALGGTYSQCPR PA
2
765-853 (89) LEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDS
PTHSTGQLK PA
2
854-874 (21) AQLVCNYVQSQQELLWEGGGR PA
2
875-888 (14) EDAPAQEPSYQSPK PA
2
889-899 (11) FLGGSQVSPSR PA
2
902-919 (18) APVNTYGPGFGPNLPNHK PA
2
920-939 (20) SGSYPTPSPCHENFVVGANR PA
2
950-962 (13) LLPPLPTCYGPLK PA
2
963-977 (15) VGGTNPSCGHPEVGR PA
2
978-1027 (50) LGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQR PA
2
1028-1052 (25) GSSGHTPPPSGPPNMAVGNMSVLLR PA
2
1053-1065 (13) SLPGETEFLNSSA PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center