Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P08151-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MSPSLGFPAQMNHQK PA
0
16-33 (18) GPSPSFGVQPCGPHDSAR PA
2
34-43 (10) GGMIPHPQSR PA
2
44-52 (9) GPFPTCQLK PA
2
53-61 (9) SELDMLVGK PA
2
64-90 (27) EEPLEGDMSSPNSTGIQDPLLGMLDGR PA
2
100-110 (11) EPESVYETDCR PA
2
111-137 (27) WDGCSQEFDSQEQLVHHINSEHIHGER PA
2
139-149 (11) EFVCHWGGCSR PA
2
156-165 (10) AQYMLVVHMR PA
8
167-174 (8) HTGEKPHK PA
8
196-212 (17) SHTGEKPYMCEHEGCSK PA
2
213-220 (8) AFSNASDR PA
8
227-237 (11) THSNEKPYVCK PA
3
245-252 (8) YTDPSSLR PA
12
257-267 (11) TVHGPDAHVTK PA
7
278-287 (10) APSISTVEPK PA
2
301-368 (68) LTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGTGLSTLR PA
2
375-387 (13) LDQLHQLRPIGTR PA
2
391-403 (13) LPSLSHTGTTVSR PA
2
405-413 (9) VGPPVSLER PA
2
415-429 (15) SSSSSSISSAYTVSR PA
2
431-462 (32) SSLASPFPPGSPPENGASSLPGLMPAQHYLLR PA
2
470-483 (14) GGGTSPTAASSLDR PA
2
484-493 (10) IGGLPMPPWR PA
2
496-509 (14) AEYPGYNPNAGVTR PA
2
511-525 (15) ASDPAQAADRPAPAR PA
2
531-573 (43) SLGCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDAR PA
2
574-618 (45) GLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGAR PA
2
619-666 (48) GPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETWGEFPSHSGLYPGPK PA
2
667-677 (11) ALGGTYSQCPR PA
2
678-766 (89) LEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDS
PTHSTGQLK PA
2
767-787 (21) AQLVCNYVQSQQELLWEGGGR PA
2
788-801 (14) EDAPAQEPSYQSPK PA
2
802-812 (11) FLGGSQVSPSR PA
2
815-832 (18) APVNTYGPGFGPNLPNHK PA
2
833-852 (20) SGSYPTPSPCHENFVVGANR PA
2
863-875 (13) LLPPLPTCYGPLK PA
2
876-890 (15) VGGTNPSCGHPEVGR PA
2
891-940 (50) LGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQR PA
2
941-965 (25) GSSGHTPPPSGPPNMAVGNMSVLLR PA
2
966-978 (13) SLPGETEFLNSSA PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center