Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P08581-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-21 (19) APAVLAPGILVLLFTLVQR PA
2
33-40 (8) SEMNVNMK PA
2
41-80 (40) YQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQK PA
2
86-104 (19) TGPVLEHPDCFPCQDCSSK PA
2
105-113 (9) ANLSGGVWK PA
2
114-138 (25) DNINMALVVDTYYDDQLISCGSVNR PA
2
144-183 (40) HVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAK PA
2
192-217 (26) FINFFVGNTINSSYFPDHPLHSISVR PA
2
224-242 (19) DGFMFLTDQSYIDVLPEFR PA
2
249-266 (18) YVHAFESNNFIYFLTVQR PA
2
267-277 (11) ETLDAQTFHTR PA
2
281-303 (23) FCSINSGLHSYMEMPLECILTEK PA
2
312-331 (20) EVFNILQAAYVSKPGAQLAR PA
2
332-359 (28) QIGASLNDDILFGVFAQSKPDSAEPMDR PA
2
360-368 (9) SAMCAFPIK PA
2
369-376 (8) YVNDFFNK PA
2
385-400 (16) CLQHFYGPNHEHCFNR PA
2
405-412 (8) NSSGCEAR PA
2
418-426 (9) TEFTTALQR PA
2
427-447 (21) VDLFMGQFSEVLLTSISTFIK PA
2
448-461 (14) GDLTIANLGTSEGR PA
2
462-469 (8) FMQVVVSR PA
2
470-508 (39) SGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGK PA
2
513-521 (9) IPLNGLGCR PA
2
522-544 (23) HFQSCSQCLSAPPFVQCGWCHDK PA
2
548-567 (20) SEECLSGTWTQQICLPAIYK PA
2
568-580 (13) VFPNSAPLEGGTR PA
2
581-591 (11) LTICGWDFGFR PA
2
603-623 (21) VLLGNESCTLTLSESTMNTLK PA
2
624-632 (9) CTVGPAMNK PA
2
633-665 (33) HFNMSIIISNGHGTTQYSTFSYVDPVITSISPK PA
2
666-688 (23) YGPMAGGTLLTLTGNYLNSGNSR PA
2
701-723 (23) SVSNSILECYTPAQTISTEFAVK PA
2
732-739 (8) ETSIFSYR PA
2
740-751 (12) EDPIVYEIHPTK PA
2
752-765 (14) SFISGGSTITGVGK PA
0
766-774 (9) NLNSVSVPR PA
1
775-784 (10) MVINVHEAGR PA
1
785-793 (9) NFTVACQHR PA
1
794-816 (23) SNSEIICCTTPSLQQLNLQLPLK PA
1
819-829 (11) AFFMLDGILSK PA
1
830-861 (32) YFDLIYVHNPVFKPFEKPVMISMGNENVLEIK PA
1
862-871 (10) GNDIDPEAVK PA
1
881-902 (22) SCENIHLHSEAVLCTVPNDLLK PA
1
903-912 (10) LNSELNIEWK PA
1
913-922 (10) QAISSTVLGK PA
1
923-956 (34) VIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLK PA
1
963-970 (8) DLGSELVR PA
1
975-982 (8) VHTPHLDR PA
1
988-1004 (17) SVSPTTEMVSNESVDYR PA
1
1005-1022 (18) ATFPEDQFPNSSQNGSCR PA
1
1023-1086 (64) QVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGR PA
1
1087-1103 (17) GHFGCVYHGTLLDNDGK PA
1
1115-1132 (18) ITDIGEVSQFLTEGIIMK PA
1
1133-1148 (16) DFSHPNVLSLLGICLR PA
1
1149-1161 (13) SEGSPLVVLPYMK PA
1
1171-1179 (9) NETHNPTVK PA
1
1180-1190 (11) DLIGFGLQVAK PA
1
1220-1227 (8) VADFGLAR PA
8
1233-1240 (8) EYYSVHNK PA
1
1249-1259 (11) WMALESLQTQK PA
1
1264-1279 (16) SDVWSFGVLLWELMTR PA
1
1280-1300 (21) GAPPYPDVNTFDITVYLLQGR PA
1
1302-1318 (17) LLQPEYCPDPLYEVMLK PA
1
1324-1336 (13) AEMRPSFSELVSR PA
1
1337-1360 (24) ISAIFSTFIGEHYVHVNATYVNVK PA
1
1361-1390 (30) CVAPYPSLLSSEDNADDEVDTRPASFWETS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center