Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P08581-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-21 (19) APAVLAPGILVLLFTLVQR PA
2
33-40 (8) SEMNVNMK PA
2
41-80 (40) YQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQK PA
2
86-104 (19) TGPVLEHPDCFPCQDCSSK PA
2
105-113 (9) ANLSGGVWK PA
2
114-138 (25) DNINMALVVDTYYDDQLISCGSVNR PA
2
144-183 (40) HVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAK PA
2
192-217 (26) FINFFVGNTINSSYFPDHPLHSISVR PA
2
224-242 (19) DGFMFLTDQSYIDVLPEFR PA
2
249-266 (18) YVHAFESNNFIYFLTVQR PA
2
267-277 (11) ETLDAQTFHTR PA
2
281-303 (23) FCSINSGLHSYMEMPLECILTEK PA
2
312-331 (20) EVFNILQAAYVSKPGAQLAR PA
2
332-359 (28) QIGASLNDDILFGVFAQSKPDSAEPMDR PA
2
360-368 (9) SAMCAFPIK PA
2
369-376 (8) YVNDFFNK PA
2
385-400 (16) CLQHFYGPNHEHCFNR PA
2
405-412 (8) NSSGCEAR PA
2
418-426 (9) TEFTTALQR PA
2
427-447 (21) VDLFMGQFSEVLLTSISTFIK PA
2
448-461 (14) GDLTIANLGTSEGR PA
2
462-469 (8) FMQVVVSR PA
2
470-508 (39) SGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGK PA
2
513-521 (9) IPLNGLGCR PA
2
522-544 (23) HFQSCSQCLSAPPFVQCGWCHDK PA
2
548-567 (20) SEECLSGTWTQQICLPAIYK PA
2
568-580 (13) VFPNSAPLEGGTR PA
2
581-591 (11) LTICGWDFGFR PA
2
603-623 (21) VLLGNESCTLTLSESTMNTLK PA
2
624-632 (9) CTVGPAMNK PA
2
633-665 (33) HFNMSIIISNGHGTTQYSTFSYVDPVITSISPK PA
2
666-688 (23) YGPMAGGTLLTLTGNYLNSGNSR PA
2
701-723 (23) SVSNSILECYTPAQTISTEFAVK PA
2
732-739 (8) ETSIFSYR PA
2
740-751 (12) EDPIVYEIHPTK PA
2
752-759 (8) SFISTWWK PA
0
760-783 (24) EPLNIVSFLFCFASGGSTITGVGK PA
0
784-792 (9) NLNSVSVPR PA
1
793-802 (10) MVINVHEAGR PA
1
803-811 (9) NFTVACQHR PA
1
812-834 (23) SNSEIICCTTPSLQQLNLQLPLK PA
1
837-847 (11) AFFMLDGILSK PA
1
848-879 (32) YFDLIYVHNPVFKPFEKPVMISMGNENVLEIK PA
1
880-889 (10) GNDIDPEAVK PA
1
899-920 (22) SCENIHLHSEAVLCTVPNDLLK PA
1
921-930 (10) LNSELNIEWK PA
1
931-940 (10) QAISSTVLGK PA
1
941-974 (34) VIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLK PA
1
981-988 (8) DLGSELVR PA
1
993-1000 (8) VHTPHLDR PA
1
1006-1022 (17) SVSPTTEMVSNESVDYR PA
1
1023-1040 (18) ATFPEDQFPNSSQNGSCR PA
1
1041-1104 (64) QVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGR PA
1
1105-1121 (17) GHFGCVYHGTLLDNDGK PA
1
1133-1150 (18) ITDIGEVSQFLTEGIIMK PA
1
1151-1166 (16) DFSHPNVLSLLGICLR PA
1
1167-1179 (13) SEGSPLVVLPYMK PA
1
1189-1197 (9) NETHNPTVK PA
1
1198-1208 (11) DLIGFGLQVAK PA
1
1238-1245 (8) VADFGLAR PA
8
1251-1258 (8) EYYSVHNK PA
1
1267-1277 (11) WMALESLQTQK PA
1
1282-1297 (16) SDVWSFGVLLWELMTR PA
1
1298-1318 (21) GAPPYPDVNTFDITVYLLQGR PA
1
1320-1336 (17) LLQPEYCPDPLYEVMLK PA
1
1342-1354 (13) AEMRPSFSELVSR PA
1
1355-1378 (24) ISAIFSTFIGEHYVHVNATYVNVK PA
1
1379-1408 (30) CVAPYPSLLSSEDNADDEVDTRPASFWETS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center