Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P09211-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MPPYTVVYFPVR PA
0
20-30 (11) MLLADQGQSWK PA
0
31-45 (15) EEVVTVETWQEGSLK PA
0
46-55 (10) ASCLYGQLPK PA
0
56-71 (16) FQDGDLTLYQSNTILR PA
0
83-101 (19) DQQEAALVDMVNDGVEDLR PA
0
104-116 (13) YISLIYTNYEAGK PA
0
122-141 (20) ALPGQLKPFETLLSQNQGGK PA
0
142-183 (42) TFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGR PA
0
192-209 (18) AFLASPEYVNLPINGNGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center