Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P0C628-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-51 (45) ILVTHFVLTGLTDHPGLQAPLFLVFLVIYLITLVGNLGLMALIWK PA
0
52-80 (29) DPHLHTPIYLFLGSLAFADACTSSSVTSK PA
0
81-88 (8) MLINFLSK PA
0
89-96 (8) NHMLSMAK PA
0
97-122 (26) CATQFYFFGSNATTECFLLVVMAYDR PA
0
123-165 (43) YVAICNPLLYPVVMSNSLCTQFIGISYFIGFLHSAIHVGLLFR PA
0
171-186 (16) SNIIHYFYCEILQLFK PA
0
187-227 (41) ISCTNPTVNILLIFIFSAFIQVFTFMTLIVSYSYILSAILK PA
0
237-263 (27) AFSTCSAHLLSVSLFYGTLFFMYVSSR PA
0
264-272 (9) SGSAADQAK PA
0
273-293 (21) MYSLFYTIIIPLLNPFIYSLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center