Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P0C7M6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-17 (10) GGPDEDAVER PA
0
23-31 (9) LLLAQLHHR PA
0
36-45 (10) AAGQIQAWWR PA
0
52-59 (8) TLLVAALR PA
0
60-68 (9) AWMIQCWWR PA
0
85-95 (11) VYVIQEQATVK PA
0
111-143 (33) QMCNALCLFQVPESSLAFQTDGFLQVQYAIPSK PA
0
144-154 (11) QPEFHIEILSI PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center