Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P0CJ88-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MALPTPSDSTLPAEAR PA
7
24-35 (12) LVWTPSQSEALR PA
7
41-49 (9) NPYPGIATR PA
7
52-62 (11) LAQAIGIPEPR PA
8
63-71 (9) VQIWFQNER PA
8
81-88 (8) ESRPWPGR PA
7
99-111 (13) TAVTGSQTALLLR PA
7
130-137 (8) ETGLPESR PA
8
138-145 (8) IQIWFQNR PA
10
156-213 (58) APAQAGGLCSAAPGGGHPAPSWVAFAHTGAWGTGLPAPHVPCAPGALPQGAFVSQAAR PA
7
214-236 (23) AAPALQPSQAAPAEGVSQPAPAR PA
5
237-258 (22) GDFAYAAPAPPDGALSHPQAPR PA
7
275-314 (40) DGLPGPCAVAQPGPAQAGPQGQGVLAPPTSQGSPWWGWGR PA
7
315-345 (31) GPQVAGAAWEPQAGAAPPPQPAPPDASASAR PA
5
346-418 (73) QGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYR PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center