Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P10721-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-19 (14) GAWDFLCVLLLLLR PA
2
20-43 (24) VQTGSSQPSVSPGEPSPPSIHPGK PA
2
56-65 (10) LLCTDPGFVK PA
2
66-78 (13) WTFEILDETNENK PA
2
79-86 (8) QNEWITEK PA
2
87-94 (8) AEATNTGK PA
2
101-112 (12) HGLSNSIYVFVR PA
2
128-135 (8) EDNDTLVR PA
2
136-149 (14) CPLTDPEVTNYSLK PA
2
150-158 (9) GCQGKPLPK PA
2
182-193 (12) LCLHCSVDQEGK PA
2
210-218 (9) AVPVVSVSK PA
2
225-236 (12) EGEEFTVTCTIK PA
2
237-247 (11) DVSSSVYSTWK PA
2
259-271 (13) YNSWHHGDFNYER PA
2
272-281 (10) QATLTISSAR PA
2
282-310 (29) VNDSGVFMCYANNTFGSANVTTTLEVVDK PA
2
311-353 (43) GFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNR PA
2
365-372 (8) SENESNIR PA
2
373-381 (9) YVSELHLTR PA
2
384-420 (37) GTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR PA
1
421-449 (29) LVNGMLQCVAAGFPEPTIDWYFCPGTEQR PA
1
450-471 (22) CSASVLPVDVQTLNSSGPPFGK PA
1
472-484 (13) LVVQSSIDSSAFK PA
1
485-492 (8) HNGTVECK PA
1
500-509 (10) TSAYFNFAFK PA
1
510-542 (33) EQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYK PA
1
543-554 (12) YLQKPMYEVQWK PA
1
555-577 (23) VVEEINGNNYVYIDPTQLPYDHK PA
1
590-598 (9) TLGAGAFGK PA
2
599-609 (11) VVEATAYGLIK PA
1
610-619 (10) SDAAMTVAVK PA
1
620-630 (11) MLKPSAHLTER PA
1
631-638 (8) EALMSELK PA
4
639-679 (41) VLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLR PA
1
690-700 (11) QEDHAEAALYK PA
1
707-731 (25) ESSCSDSTNEYMDMKPGVSYVVPTK PA
1
747-774 (28) DVTPAIMEDDELALDLEDLLSFSYQVAK PA
1
775-782 (8) GMAFLASK PA
1
793-800 (8) NILLTHGR PA
1
804-811 (8) ICDFGLAR PA
18
815-822 (8) NDSNYVVK PA
1
831-874 (44) WMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSK PA
1
885-900 (16) MLSPEHAPAEMYDIMK PA
1
901-909 (9) TCWDADPLK PA
1
915-922 (8) QIVQLIEK PA
1
923-942 (20) QISESTNHIYSNLANCSPNR PA
1
943-952 (10) QKPVVDHSVR PA
1
953-972 (20) INSVGSTASSSQPLLVHDDV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center