Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P10721-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-19 (14) GAWDFLCVLLLLLR PA
2
20-43 (24) VQTGSSQPSVSPGEPSPPSIHPGK PA
2
56-65 (10) LLCTDPGFVK PA
2
66-78 (13) WTFEILDETNENK PA
2
79-86 (8) QNEWITEK PA
2
87-94 (8) AEATNTGK PA
2
101-112 (12) HGLSNSIYVFVR PA
2
128-135 (8) EDNDTLVR PA
2
136-149 (14) CPLTDPEVTNYSLK PA
2
150-158 (9) GCQGKPLPK PA
2
182-193 (12) LCLHCSVDQEGK PA
2
210-218 (9) AVPVVSVSK PA
2
225-236 (12) EGEEFTVTCTIK PA
2
237-247 (11) DVSSSVYSTWK PA
2
259-271 (13) YNSWHHGDFNYER PA
2
272-281 (10) QATLTISSAR PA
2
282-310 (29) VNDSGVFMCYANNTFGSANVTTTLEVVDK PA
2
311-353 (43) GFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNR PA
2
365-372 (8) SENESNIR PA
2
373-381 (9) YVSELHLTR PA
2
384-413 (30) GTEGGTYTFLVSNSDVNAAIAFNVYVNTSL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center