Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P10911-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-38 (23) NAASFPGNLHLVLVLRPTSFLQR PA
3
39-55 (17) TFTDIGFWFSQEDFMLK PA
5
56-74 (19) LPVVMLSSVSDLLTYIDDK PA
4
75-95 (21) QLTPELGGTLQYCHSEWIIFR PA
4
96-106 (11) NAIENFALTVK PA
4
107-138 (32) EMAQMLQSFGTELAETELPDDIPSIEEILAIR PA
5
147-154 (8) NDITAVTK PA
5
158-175 (18) ILLTNLEVPDTEGAVSSR PA
5
181-191 (11) QISGDWQTINK PA
5
192-209 (18) LLTQVHDMETAFDGFWEK PA
5
214-222 (9) MEQYLQLWK PA
5
223-255 (33) FEQDFQQLVTEVEFLLNQQAELADVTGTIAQVK PA
5
261-274 (14) LENLDENSQELLSK PA
5
275-284 (10) AQFVILHGHK PA
5
285-299 (15) LAANHHYALDLICQR PA
5
305-315 (11) YLSDILVNEIK PA
5
336-352 (17) QCCDEGECLLANQEIDK PA
5
362-397 (36) ALQDIENFLEMALPFINYEPETLQYEFDVILSPELK PA
5
412-422 (11) SIFENQQAGFR PA
5
428-453 (26) HVRPIQFVVPTPENLVTSGTPFFSSK PA
5
454-466 (13) QVGVGYSFFQACK PA
1
484-493 (10) IEVVPDCQEK PA
5
495-512 (18) SSGPSSSLDNGNSLDVLK PA
5
513-524 (12) NHVLNELIQTER PA
5
529-538 (10) ELYTVLLGYR PA
5
539-555 (17) AEMDNPEMFDLMPPLLR PA
5
559-589 (31) DILFGNMAEIYEFHNDIFLSSLENCAHAPER PA
5
590-597 (8) VGPCFLER PA
5
599-606 (8) DDFQMYAK PA
5
621-632 (12) YSECAFFQECQR PA
5
640-650 (11) LDSYLLKPVQR PA
5
667-675 (9) DCEGSALLK PA
5
677-686 (10) ALDAMLDLLK PA
5
687-709 (23) SVNDSMHQIAINGYIGNLNELGK PA
5
710-723 (14) MIMQGGFSVWIGHK PA
5
756-764 (9) VESGEGSDR PA
5
776-786 (11) MDEVGITEYVK PA
5
792-799 (8) FEIWYGEK PA
5
800-813 (14) EEVYIVQASNVDVK PA
5
827-834 (8) QQELLTVK PA
5
838-845 (8) QQDQLTER PA
5
848-858 (11) FQISLQQNDEK PA
3
859-941 (83) QQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEENRPLMRPVSEMA
LLY PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center