Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P10911-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MQDIAFLSGGR PA
1
14-28 (15) DNAWIITFPENCNFR PA
1
29-37 (9) CIPEEVIAK PA
1
38-47 (10) VLTYLTSIAR PA
1
63-70 (8) LDTWSSLK PA
1
76-98 (23) ISASFPGNLHLVLVLRPTSFLQR PA
1
99-115 (17) TFTDIGFWFSQEDFMLK PA
5
116-134 (19) LPVVMLSSVSDLLTYIDDK PA
4
135-155 (21) QLTPELGGTLQYCHSEWIIFR PA
4
156-166 (11) NAIENFALTVK PA
4
167-198 (32) EMAQMLQSFGTELAETELPDDIPSIEEILAIR PA
5
207-214 (8) NDITAVTK PA
5
218-235 (18) ILLTNLEVPDTEGAVSSR PA
5
241-251 (11) QISGDWQTINK PA
5
252-269 (18) LLTQVHDMETAFDGFWEK PA
5
274-282 (9) MEQYLQLWK PA
5
283-315 (33) FEQDFQQLVTEVEFLLNQQAELADVTGTIAQVK PA
5
321-334 (14) LENLDENSQELLSK PA
5
335-344 (10) AQFVILHGHK PA
5
345-359 (15) LAANHHYALDLICQR PA
5
365-375 (11) YLSDILVNEIK PA
5
396-412 (17) QCCDEGECLLANQEIDK PA
5
422-457 (36) ALQDIENFLEMALPFINYEPETLQYEFDVILSPELK PA
5
472-482 (11) SIFENQQAGFR PA
5
488-513 (26) HVRPIQFVVPTPENLVTSGTPFFSSK PA
5
514-526 (13) QVGVGYSFFQACK PA
1
544-553 (10) IEVVPDCQEK PA
5
555-572 (18) SSGPSSSLDNGNSLDVLK PA
5
573-584 (12) NHVLNELIQTER PA
5
589-598 (10) ELYTVLLGYR PA
5
599-615 (17) AEMDNPEMFDLMPPLLR PA
5
619-649 (31) DILFGNMAEIYEFHNDIFLSSLENCAHAPER PA
5
650-657 (8) VGPCFLER PA
5
659-666 (8) DDFQMYAK PA
5
681-692 (12) YSECAFFQECQR PA
5
700-710 (11) LDSYLLKPVQR PA
5
727-735 (9) DCEGSALLK PA
5
737-746 (10) ALDAMLDLLK PA
5
747-769 (23) SVNDSMHQIAINGYIGNLNELGK PA
5
770-783 (14) MIMQGGFSVWIGHK PA
5
816-824 (9) VESGEGSDR PA
5
836-846 (11) MDEVGITEYVK PA
5
852-859 (8) FEIWYGEK PA
5
860-873 (14) EEVYIVQASNVDVK PA
5
887-894 (8) QQELLTVK PA
5
898-905 (8) QQDQLTER PA
5
908-918 (11) FQISLQQNDEK PA
3
919-1001 (83) QQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEENRPLMRPVSEMA
LLY PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center