Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P10911-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-38 (23) NAASFPGNLHLVLVLRPTSFLQR PA
3
39-55 (17) TFTDIGFWFSQEDFMLK PA
5
56-67 (12) LPAIENFALTVK PA
0
68-99 (32) EMAQMLQSFGTELAETELPDDIPSIEEILAIR PA
5
108-115 (8) NDITAVTK PA
5
119-136 (18) ILLTNLEVPDTEGAVSSR PA
5
142-152 (11) QISGDWQTINK PA
5
153-170 (18) LLTQVHDMETAFDGFWEK PA
5
175-183 (9) MEQYLQLWK PA
5
184-216 (33) FEQDFQQLVTEVEFLLNQQAELADVTGTIAQVK PA
5
222-235 (14) LENLDENSQELLSK PA
5
236-245 (10) AQFVILHGHK PA
5
246-260 (15) LAANHHYALDLICQR PA
5
266-276 (11) YLSDILVNEIK PA
5
297-313 (17) QCCDEGECLLANQEIDK PA
5
323-358 (36) ALQDIENFLEMALPFINYEPETLQYEFDVILSPELK PA
5
373-383 (11) SIFENQQAGFR PA
5
389-414 (26) HVRPIQFVVPTPENLVTSGTPFFSSK PA
5
429-438 (10) IEVVPDCQEK PA
5
440-457 (18) SSGPSSSLDNGNSLDVLK PA
5
458-469 (12) NHVLNELIQTER PA
5
474-483 (10) ELYTVLLGYR PA
5
484-500 (17) AEMDNPEMFDLMPPLLR PA
5
504-534 (31) DILFGNMAEIYEFHNDIFLSSLENCAHAPER PA
5
535-542 (8) VGPCFLER PA
5
544-551 (8) DDFQMYAK PA
5
566-577 (12) YSECAFFQECQR PA
5
585-595 (11) LDSYLLKPVQR PA
5
612-620 (9) DCEGSALLK PA
5
622-631 (10) ALDAMLDLLK PA
5
632-654 (23) SVNDSMHQIAINGYIGNLNELGK PA
5
655-668 (14) MIMQGGFSVWIGHK PA
5
701-709 (9) VESGEGSDR PA
5
721-731 (11) MDEVGITEYVK PA
5
737-744 (8) FEIWYGEK PA
5
745-758 (14) EEVYIVQASNVDVK PA
5
772-779 (8) QQELLTVK PA
5
783-790 (8) QQDQLTER PA
5
793-806 (14) FQISLQQNDEDLCR PA
1
808-821 (14) WLSYIDEATMSNGK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center