Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P14618-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCR PA
1
33-43 (11) LDIDSPPITAR PA
1
44-56 (13) NTGIICTIGPASR PA
1
74-89 (16) LNFSHGTHEYHAETIK PA
1
93-115 (23) TATESFASDPILYRPVAVALDTK PA
2
126-135 (10) GSGTAEVELK PA
2
142-151 (10) ITLDNAYMEK PA
2
152-162 (11) CDENILWLDYK PA
2
174-186 (13) IYVDDGLISLQVK PA
2
189-206 (18) GADFLVTEVENGGSLGSK PA
2
208-224 (17) GVNLPGAAVDLPAVSEK PA
2
231-246 (16) FGVEQDVDMVFASFIR PA
2
248-255 (8) ASDVHEVR PA
2
271-278 (8) IENHEGVR PA
2
280-294 (15) FDEILEASDGIMVAR PA
2
295-305 (11) GDLGIEIPAEK PA
4
320-336 (17) AGKPVICATQMLESMIK PA
2
343-367 (25) AEGSDVANAVLDGADCIMLSGETAK PA
2
368-376 (9) GDYPLEAVR PA
2
384-399 (16) EAEAAIYHLQLFEELR PA
1
401-422 (22) LAPITSDPTEATAVGAVEASFK PA
1
423-433 (11) CCSGAIIVLTK PA
1
448-455 (8) APIIAVTR PA
2
468-475 (8) GIFPVLCK PA
2
476-489 (14) DPVQEAWAEDVDLR PA
2
490-498 (9) VNFAMNVGK PA
2
506-526 (21) GDVVIVLTGWRPGSGFTNTMR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center