Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P14618-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MSPEAQPQR PA
0
19-74 (56) SPIVKPGLPSFRPSSCTQPWLTHSWSTCAAWTLIHHPSQPGTLASSVPLYHAETIK PA
0
78-100 (23) TATESFASDPILYRPVAVALDTK PA
2
111-120 (10) GSGTAEVELK PA
2
127-136 (10) ITLDNAYMEK PA
2
137-147 (11) CDENILWLDYK PA
2
159-171 (13) IYVDDGLISLQVK PA
2
174-191 (18) GADFLVTEVENGGSLGSK PA
2
193-209 (17) GVNLPGAAVDLPAVSEK PA
2
216-231 (16) FGVEQDVDMVFASFIR PA
2
233-240 (8) ASDVHEVR PA
2
256-263 (8) IENHEGVR PA
2
265-279 (15) FDEILEASDGIMVAR PA
2
280-290 (11) GDLGIEIPAEK PA
4
305-321 (17) AGKPVICATQMLESMIK PA
2
328-352 (25) AEGSDVANAVLDGADCIMLSGETAK PA
2
353-361 (9) GDYPLEAVR PA
2
369-384 (16) EAEAAIYHLQLFEELR PA
1
386-407 (22) LAPITSDPTEATAVGAVEASFK PA
1
408-418 (11) CCSGAIIVLTK PA
1
433-440 (8) APIIAVTR PA
2
453-460 (8) GIFPVLCK PA
2
461-474 (14) DPVQEAWAEDVDLR PA
2
475-483 (9) VNFAMNVGK PA
2
491-511 (21) GDVVIVLTGWRPGSGFTNTMR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center