Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P15036-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-20 (13) NMDQVAPVANSYR PA
0
26-76 (51) QPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSK PA
0
77-84 (8) AVMSQALK PA
0
102-131 (30) NPWLWSEQQVCQWLLWATNEFSLVNVNLQR PA
0
132-144 (13) FGMNGQMLCNLGK PA
0
147-168 (22) FLELAPDFVGDILWEHLEQMIK PA
0
174-214 (41) TEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPK PA
0
215-241 (27) GGLLDSMCPASTPSVLSSEQEFQMFPK PA
0
244-274 (31) LSSVSVTYCSVSQDFPGSNLNLLTNNSGTPK PA
0
275-307 (33) DHDSPENGADSFESSDSLLQSWNSQSSLLDVQR PA
0
308-332 (25) VPSFESFEDDCSQSLCLNKPTMSFK PA
0
339-376 (38) SDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDK PA
0
377-392 (16) SCQSFISWTGDGWEFK PA
4
393-401 (9) LADPDEVAR PA
0
442-469 (28) FVCDLQNLLGFTPEELHAILGVQPDTED PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center