Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P15336-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
15-35 (21) DLWNMSDDKPFLCTAPGCGQR PA
1
36-46 (11) FTNEDHLAVHK PA
9
60-74 (15) NDSVIVADQTPTPTR PA
3
78-97 (20) NCEEVGLFNELASPFENEFK PA
4
107-120 (14) MPLDLSPLATPIIR PA
4
123-149 (27) IEEPSVVETTHQDSPLPHPESTTSDEK PA
4
150-275 (126) EVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPV
AIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAK PA
2
280-296 (17) AALTQQHPPVTNGDTVK PA
3
297-304 (8) GHGSGLVR PA
3
305-342 (38) TQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGR PA
3
346-354 (9) AANEDPDEK PA
3
375-382 (8) VWVQSLEK PA
3
384-402 (19) AEDLSSLNGQLQSEVTLLR PA
3
417-425 (9) DCPVTAMQK PA
5
427-434 (8) SGYHTADK PA
5
435-468 (34) DDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSK PA
5
469-505 (37) AEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center