Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P15336-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-99 (99) MSTAYFQMMQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAK PA
0
104-120 (17) AALTQQHPPVTNGDTVK PA
3
121-128 (8) GHGSGLVR PA
3
129-166 (38) TQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGR PA
3
170-178 (9) AANEDPDEK PA
3
199-206 (8) VWVQSLEK PA
3
208-226 (19) AEDLSSLNGQLQSEVTLLR PA
3
241-249 (9) DCPVTAMQK PA
5
251-258 (8) SGYHTADK PA
5
259-292 (34) DDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSK PA
5
293-329 (37) AEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center