Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P15336-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MSDDKPFLCTAPGCGQR PA
1
18-28 (11) FTNEDHLAVHK PA
9
42-56 (15) NDSVIVADQTPTPTR PA
3
60-79 (20) NCEEVGLFNELASPFENEFK PA
4
89-102 (14) MPLDLSPLATPIIR PA
4
105-131 (27) IEEPSVVETTHQDSPLPHPESTTSDEK PA
4
132-257 (126) EVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPV
AIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAK PA
2
262-278 (17) AALTQQHPPVTNGDTVK PA
3
279-286 (8) GHGSGLVR PA
3
287-324 (38) TQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGR PA
3
328-336 (9) AANEDPDEK PA
3
357-364 (8) VWVQSLEK PA
3
366-384 (19) AEDLSSLNGQLQSEVTLLR PA
3
399-407 (9) DCPVTAMQK PA
5
409-416 (8) SGYHTADK PA
5
417-450 (34) DDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSK PA
5
451-487 (37) AEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center