Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P15336-7)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MSDDKPFLCTAPGCGQR PA
1
18-28 (11) FTNEDHLAVHK PA
9
42-56 (15) NDSVIVADQTPTPTR PA
3
60-79 (20) NCEEVGLFNELASPFENEFK PA
4
89-102 (14) MPLDLSPLATPIIR PA
4
105-131 (27) IEEPSVVETTHQDSPLPHPESTTSDEK PA
4
132-217 (86) EVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVSFDQSPWCLVFQESQVLPLPNQYSQK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center