Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P15531-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-31 (31) MVLLSTLGIVFQGEGPPISSCDTGTMANCER PA
0
32-43 (12) TFIAIKPDGVQR PA
3
44-51 (8) GLVGEIIK PA
3
65-74 (10) FMQASEDLLK PA
2
82-91 (10) DRPFFAGLVK PA
2
92-110 (19) YMHSGPVVAMVWEGLNVVK PA
2
114-130 (17) VMLGETNPADSKPGTIR PA
3
131-139 (9) GDFCIQVGR PA
3
140-153 (14) NIIHGSDSVESAEK PA
1
154-177 (24) EIGLWFHPEELVDYTSCAQNWIYE PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center