Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P15622-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-21 (16) LLPVPAGPQPLSFQAK PA
0
22-38 (17) LTFEDVAVLLSQDEWDR PA
2
49-76 (28) NVMMETYGNVVSLGLPGSKPDIISQLER PA
2
77-85 (9) GEDPWVLDR PA
2
91-103 (13) SQGLWSDYSDNLK PA
2
104-125 (22) YDHTTACTQQDSLSCPWECETK PA
2
126-148 (23) GESQNTDLSPKPLISEQTVILGK PA
2
154-162 (9) IDQENNETK PA
2
163-175 (13) QSFCLSPNSVDHR PA
2
176-206 (31) EVQVLSQSMPLTPHQAVPSGERPYMCVECGK PA
2
211-219 (9) SSHLLQHQR PA
2
220-234 (15) IHTGEKPYVCSVCGK PA
2
235-244 (10) AFSQSSVLSK PA
2
248-262 (15) IHTGEKPYECNECGK PA
22
266-275 (10) VSSDLAQHHK PA
2
276-289 (14) IHTGEKPHECLECR PA
2
291-303 (13) AFTQLSHLIQHQR PA
2
304-318 (15) IHTGERPYVCPLCGK PA
2
319-327 (9) AFNHSTVLR PA
2
332-340 (9) VHTGEKPHR PA
3
360-374 (15) IHTGEKPYTCSECGK PA
1
380-402 (23) SVLIQHHNVHTGEKPYECSECGK PA
1
408-415 (8) STLMNHER PA
1
416-430 (15) IHTEEKPYACYECGK PA
1
431-443 (13) AFVQHSHLIQHQR PA
1
444-463 (20) VHTGEKPYVCGECGHAFSAR PA
1
472-486 (15) IHTGEKPFQCTECGK PA
2
492-499 (8) ATLIVHLR PA
2
500-514 (15) THTGEKPYECNSCGK PA
2
515-527 (13) AFSQYSVLIQHQR PA
2
528-542 (15) IHTGEKPYECGECGR PA
2
543-555 (13) AFNQHGHLIQHQK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center