Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P15622-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-16 (11) LLPVPAGPQAK PA
1
17-33 (17) LTFEDVAVLLSQDEWDR PA
2
44-71 (28) NVMMETYGNVVSLGLPGSKPDIISQLER PA
2
72-80 (9) GEDPWVLDR PA
2
86-98 (13) SQGLWSDYSDNLK PA
2
99-120 (22) YDHTTACTQQDSLSCPWECETK PA
2
121-143 (23) GESQNTDLSPKPLISEQTVILGK PA
2
149-157 (9) IDQENNETK PA
2
158-170 (13) QSFCLSPNSVDHR PA
2
171-201 (31) EVQVLSQSMPLTPHQAVPSGERPYMCVECGK PA
2
206-214 (9) SSHLLQHQR PA
2
215-229 (15) IHTGEKPYVCSVCGK PA
2
230-239 (10) AFSQSSVLSK PA
2
243-257 (15) IHTGEKPYECNECGK PA
22
261-270 (10) VSSDLAQHHK PA
2
271-284 (14) IHTGEKPHECLECR PA
2
286-298 (13) AFTQLSHLIQHQR PA
2
299-313 (15) IHTGERPYVCPLCGK PA
2
314-322 (9) AFNHSTVLR PA
2
327-335 (9) VHTGEKPHR PA
3
355-369 (15) IHTGEKPFQCTECGK PA
2
375-382 (8) ATLIVHLR PA
2
383-397 (15) THTGEKPYECNSCGK PA
2
398-410 (13) AFSQYSVLIQHQR PA
2
411-425 (15) IHTGEKPYECGECGR PA
2
426-438 (13) AFNQHGHLIQHQK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center