Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P18848-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-42 (42) MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAK PA
0
43-53 (11) HFKPHGFSSDK PA
0
56-75 (20) AGSSEWLAVDGLVSPSNNSK PA
0
76-88 (13) EDAFSGTDWMLEK PA
0
93-132 (40) EFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNK PA
0
133-193 (61) QPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDR PA
0
194-209 (16) KPDYTAYVAMIPQCIK PA
0
210-239 (30) EEDTPSDNDSGICMSPESYLGSPQHSPSTR PA
0
245-267 (23) SLPSPGVLCGSARPKPYDPPGEK PA
0
301-311 (11) AEQEALTGECK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center