Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P19404-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MFFSAALR PA
0
11-20 (10) AAGLTAHWGR PA
0
28-42 (15) TVMQNGAGGALFVHR PA
0
43-61 (19) DTPENNPDTPFDFTPENYK PA
0
76-88 (13) AAAVLPVLDLAQR PA
0
89-100 (12) QNGWLPISAMNK PA
0
101-111 (11) VAEVLQVPPMR PA
0
112-124 (13) VYEVATFYTMYNR PA
0
130-143 (14) YHIQVCTTTPCMLR PA
0
144-154 (11) NSDSILEAIQK PA
0
160-167 (8) VGETTPDK PA
0
168-199 (32) LFTLIEVECLGACVNAPMVQINDNYYEDLTAK PA
0
200-209 (10) DIEEIIDELK PA
0
223-239 (17) FSCEPAGGLTSLTEPPK PA
0
240-249 (10) GPGFGVQAGL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center