Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P20591-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MVVSEVDIAK PA
1
11-31 (21) ADPAAASHPLLLNGDATVAQK PA
1
32-48 (17) NPGSVAENNLCSQYEEK PA
1
49-60 (12) VRPCIDLIDSLR PA
3
61-83 (23) ALGVEQDLALPAIAVIGDQSSGK PA
3
84-97 (14) SSVLEALSGVALPR PA
3
124-141 (18) VSYQDYEIEISDASEVEK PA
1
146-169 (24) AQNAIAGEGMGISHELITLEISSR PA
1
170-184 (15) DVPDLTLIDLPGITR PA
1
185-197 (13) VAVGNQPADIGYK PA
1
209-241 (33) QETISLVVVPSNVDIATTEALSMAQEVDPEGDR PA
1
242-254 (13) TIGILTKPDLVDK PA
1
282-298 (17) GQQEIQDQLSLSEALQR PA
1
301-310 (10) IFFENHPYFR PA
1
318-326 (9) ATVPCLAEK PA
1
327-337 (11) LTSELITHICK PA
1
338-347 (10) SLPLLENQIK PA
1
360-371 (12) YGVDIPEDENEK PA
1
379-402 (24) VNAFNQDITALMQGEETVGEEDIR PA
1
414-473 (60) WSTIIENNFQEGGQQAHLQPHPFDHPVLHAPDVRPAASEGHAAAPAGQGHLQLAPEGAER PA
0
477-500 (24) QAEVPEGAACTADAGSAPACPVPR PA
0
501-508 (8) LTTLCPAP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center