Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P20813-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-22 (22) MELSVLLFLALLTGLLLLLVQR PA
0
30-48 (19) LPPGPRPLPLLGNLLQMDR PA
0
62-85 (24) YGDVFTVHLGPRPVVMLCGVEAIR PA
1
101-109 (9) IAMVDPFFR PA
1
110-120 (11) GYGVIFANGNR PA
1
146-158 (13) IQEEAQCLIEELR PA
1
162-186 (25) GALMDPTFLFQSITANIICSIVFGK PA
0
188-197 (10) FHYQDQEFLK PA
0
198-225 (28) MLNLFYQTFSLISSVFGQLFELFSGFLK PA
0
237-251 (15) NLQEINAYIGHSVEK PA
0
254-262 (9) ETLDPSAPK PA
0
263-274 (12) DLIDTYLLHMEK PA
0
277-308 (32) SNAHSEFSHQNLNLNTLSLFFAGTETTSTTLR PA
0
309-316 (8) YGFLLMLK PA
0
327-343 (17) EIEQVIGPHRPPELHDR PA
1
346-358 (13) MPYTEAVIYEIQR PA
1
359-378 (20) FSDLLPMGVPHIVTQHTSFR PA
1
385-421 (37) DTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALK PA
1
423-433 (11) TEAFIPFSLGK PA
1
435-443 (9) ICLGEGIAR PA
1
444-479 (36) AELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGK PA
1
480-487 (8) IPPTYQIR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center