Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P20813-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-19 (17) CMLTNSHPWCGCDWQFR PA
0
22-45 (24) YGDVFTVHLGPRPVVMLCGVEAIR PA
1
61-69 (9) IAMVDPFFR PA
1
70-80 (11) GYGVIFANGNR PA
1
106-118 (13) IQEEAQCLIEELR PA
1
127-143 (17) EIEQVIGPHRPPELHDR PA
1
146-158 (13) MPYTEAVIYEIQR PA
1
159-178 (20) FSDLLPMGVPHIVTQHTSFR PA
1
185-221 (37) DTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALK PA
1
223-233 (11) TEAFIPFSLGK PA
1
235-243 (9) ICLGEGIAR PA
1
244-279 (36) AELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGK PA
1
280-287 (8) IPPTYQIR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center