Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P21439-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-28 (21) NGTAWRPTSAEGDFELGISSK PA
2
39-47 (9) MIGVLTLFR PA
2
55-84 (30) LFMSLGTIMAIAHGSGLPLMMIVFGEMTDK PA
2
85-107 (23) FVDTAGNFSFPVNFSLSLLNPGK PA
2
108-115 (8) ILEEEMTR PA
2
116-144 (29) YAYYYSGLGAGVLVAAYIQVSFWTLAAGR PA
2
160-176 (17) QEIGWFDINDTTELNTR PA
2
184-191 (8) ISEGIGDK PA
2
192-212 (21) VGMFFQAVATFFAGFIVGFIR PA
2
216-236 (21) LTLVIMAISPILGLSAAVWAK PA
2
237-244 (8) ILSAFSDK PA
2
252-264 (13) AGAVAEEALGAIR PA
2
265-274 (10) TVIAFGGQNK PA
2
294-326 (33) AISANISMGIAFLLIYASYALAFWYGSTLVISK PA
2
327-361 (35) EYTIGNAMTVFFSILIGAFSVGQAAPCIDAFANAR PA
2
362-376 (15) GAAYVIFDIIDNNPK PA
2
384-391 (8) GHKPDSIK PA
2
392-406 (15) GNLEFNDVHFSYPSR PA
2
419-435 (17) VQSGQTVALVGSSGCGK PA
2
436-444 (9) STTVQLIQR PA
2
445-461 (17) LYDPDEGTINIDGQDIR PA
2
462-469 (8) NFNVNYLR PA
2
470-494 (25) EIIGVVSQEPVLFSTTIAENICYGR PA
2
495-503 (9) GNVTMDEIK PA
2
508-517 (10) EANAYEFIMK PA
2
522-529 (8) FDTLVGER PA
4
530-538 (9) GAQLSGGQK PA
11
553-577 (25) ILLLDEATSALDTESEAEVQAALDK PA
2
583-590 (8) TTIVIAHR PA
4
596-619 (24) NADVIAGFEDGVIVEQGSHSELMK PA
2
627-648 (22) LVNMQTSGSQIQSEEFELNDEK PA
2
680-699 (20) SLDVETDGLEANVPPVSFLK PA
2
706-747 (42) TEWPYFVVGTVCAIANGGLQPAFSVIFSEIIAIFGPGDDAVK PA
2
751-778 (28) CNIFSLIFLFLGIISFFTFFLQGFTFGK PA
2
798-807 (10) QDMSWFDDHK PA
2
808-816 (9) NSTGALSTR PA
2
817-831 (15) LATDAAQVQGATGTR PA
2
832-876 (45) LALIAQNIANLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMK PA
2
895-904 (10) IATEAIENIR PA
2
905-913 (9) TVVSLTQER PA
2
915-922 (8) FESMYVEK PA
2
934-957 (24) AHIYGITFSISQAFMYFSYAGCFR PA
1
958-969 (12) FGAYLIVNGHMR PA
1
972-999 (28) DVILVFSAIVFGAVALGHASSFAPDYAK PA
1
1002-1013 (12) LSAAHLFMLFER PA
2
1014-1029 (16) QPLIDSYSEEGLKPDK PA
2
1030-1046 (17) FEGNITFNEVVFNYPTR PA
2
1047-1060 (14) ANVPVLQGLSLEVK PA
2
1062-1075 (14) GQTLALVGSSGCGK PA
4
1076-1084 (9) STVVQLLER PA
4
1085-1108 (24) FYDPLAGTVFVDFGFQLLDGQEAK PA
0
1117-1144 (28) AQLGIVSQEPILFDCSIAENIAYGDNSR PA
2
1145-1156 (12) VVSQDEIVSAAK PA
2
1157-1170 (14) AANIHPFIETLPHK PA
2
1179-1187 (9) GTQLSGGQK PA
4
1199-1218 (20) QPQILLLDEATSALDTESEK PA
2
1219-1226 (8) VVQEALDK PA
4
1232-1239 (8) TCIVIAHR PA
5
1240-1256 (17) LSTIQNADLIVVFQNGR PA
4
1259-1270 (12) EHGTHQQLLAQK PA
4
1271-1286 (16) GIYFSMVSVQAGTQNL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center